Novus Biologicals
Manufacturer Code:NBP17426420UL
Catalog # NBP17426420
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to the N terminal of PCBD2. Immunizing peptide sequence SGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSR. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 4-alpha-hydroxy-tetrahydropterin dehydratase 2; 4-alpha-hydroxy-tetrahydropterin dehydratase 2 DCOH2DCOHMPHS26-pyruvoyl-tetrahydropterin synthase/dimerization cofactor of hepatocytenuclear factor 1 alpha (TCF1) 2 DcoH-like protein DCoHm dimerization cofactor of hepatocyte nuclear factor 1 (HNF1) from muscle dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) Dimerization cofactor of hepatocyte nuclear factor 1 from muscle EC 4.2.1.96 HNF-1-alpha dimerization cofactor PHS 2 pterin-4 alpha-carbinolamine dehydratase 2 pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocytenuclear factor 1 alpha (TCF1) 2 pterin-4-alpha-carbinolamine dehydratase 2; 6-pyruvoyl-tetrahydropterin synthase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2; DcoH-like protein DCoHm; dimerization cofactor of hepatocyte nuclear factor 1 (HNF1) from muscle; dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1); Dimerization cofactor of hepatocyte nuclear factor 1 from muscle; HNF-1-alpha dimerization cofactor; PHS 2; pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2; Pterin-4-alpha-carbinolamine dehydratase 2
Gene Aliases: DCOH2; DCOHM; PCBD2; PHS2
UniProt ID: (Human) Q9H0N5
Entrez Gene ID: (Human) 84105
Molecular Function:
dehydratase
lyase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.