Novus Biologicals
Manufacturer Code:NBP182376
Catalog # NBP182376
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide towards Pcbd1. Peptide sequence VALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVS. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 4-alpha-hydroxy-tetrahydropterin dehydratase; 4-alpha-hydroxy-tetrahydropterin dehydratase DCoH DCOHpterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocytenuclear factor 1 alpha (TCF1) Dimerization cofactor of hepatocyte nuclear factor 1-alpha Dimerization cofactor of HNF1 PCBDdimerizing cofactor for HNF16-pyruvoyl-tetrahydropterin synthase/dimerization cofactor of hepatocytenuclear factor 1 alpha (TCF1) PCDEC 4.2.1.96 Phenylalanine hydroxylase-stimulating protein PHS Pterin carbinolamine dehydratase pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocytenuclear factor 1 alpha pterin-4-alpha-carbinolamine dehydratase; 6-pyruvoyl-tetrahydropterin synthase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1); DCoH; Dimerization cofactor of hepatocyte nuclear factor 1-alpha; dimerizing cofactor for HNF1; PCD; Phenylalanine hydroxylase-stimulating protein; PHS; Pterin carbinolamine dehydratase; pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha; Pterin-4-alpha-carbinolamine dehydratase
Gene Aliases: DCOH; PCBD; PCBD1; PCD; PHS
UniProt ID: (Human) P61457
Entrez Gene ID: (Human) 5092
Molecular Function:
dehydratase
lyase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.