Novus Biologicals
Manufacturer Code:NBP152877
Catalog # NBP152877
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PBEF1(pre-B-cell colony enhancing factor 1) The peptide sequence was selected from the C terminal of PBEF1 (NP_005737). Peptide sequence VTLEEGKGDLEEYGQDLLHTVFKNGKVTKSYSFDEIRKNAQLNIELEAAH. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
For Research Use Only
Protein Aliases: EC 2.4.2.12 MGC117256 NAmPRTase Nampt nicotinamide phosphoribosyltransferase PBEF1110035O14Rik PBEF1DKFZp666B131 Pre-B cell-enhancing factor pre-B-cell colony enhancing factor 1 Pre-B-cell colony-enhancing factor 1 VF VISFATIN; NAmPRTase; Nicotinamide phosphoribosyltransferase; Pre-B cell-enhancing factor; pre-B-cell colony enhancing factor 1; Pre-B-cell colony-enhancing factor 1; Visfatin
Gene Aliases: 1110035O14Rik; NAMPT; PBEF; PBEF1; VF; VISFATIN
UniProt ID: (Human) P43490
Entrez Gene ID: (Human) 10135
Molecular Function:
cytokine
signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.