Novus Biologicals
Manufacturer Code:NBP257056
Catalog # NBP257056
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LVGPMEITMGSLEKAGPVSPGCVKLAGQEGLVEMVLLMEPGAMRFLQLYHEDLLAGLGDVALLPLEGPDMTGFRLCG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ADP-ribosyltransferase diphtheria toxin-like 10; ARTD10; EC 2.4.2.30 FLJ14464 PARP-10 poly (ADP-ribose) polymerase family member 10 poly [ADP-ribose] polymerase 10; PARP-10; poly (ADP-ribose) polymerase family, member 10; Poly [ADP-ribose] polymerase 10; Protein mono-ADP-ribosyltransferase PARP10
Gene Aliases: ARTD10; PARP10
UniProt ID: (Human) Q53GL7
Entrez Gene ID: (Human) 84875
Molecular Function: nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.