Novus Biologicals
Manufacturer Code:NBP189450
Catalog # NBP189450
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:WQRRCTEIVAIDALHFRRYLDQFVPEKMRRELNKAYCGFLRPGVSSENLSAVATGNWGCGAFGGDARLKALIQILAAAA |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 3.2.1.143 FLJ54459 FLJ60257 FLJ60456 PARG99 poly (ADP-ribose) glycohydrolase poly(ADP-ribose) glycohydrolase poly(ADP-ribose) glycohydrolase 60 kDa isoform; mitochondrial poly(ADP-ribose) glycohydrolase; poly (ADP-ribose) glycohydrolase; Poly(ADP-ribose) glycohydrolase; poly(ADP-ribose) glycohydrolase 60 kDa isoform
Gene Aliases: PARG; PARG99
UniProt ID: (Human) Q86W56
Entrez Gene ID: (Human) 8505
Molecular Function:
glycosidase
hydrolase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.