Novus Biologicals
Manufacturer Code:NBP238487
Catalog # NBP238487
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DLVIENRQPPSSNGLSQGPPCWDLHPGCRHPGTRSSLPSLDDQEQASSGWGSRIRGDGSGFS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: PAR-6; PAR-6 alpha; PAR-6 PAR-6 alpha par-6 partitioning defective 6 homolog alpha (C. elegans) PAR6A PAR6alpha PAR-6Apar-6 (partitioning defective 6 C.elegans) homolog alpha PAR6C partitioning defective 6 homolog alpha partitioning defective-6 homolog alpha partitioning-defective protein 6 Tax interaction protein 40 TAX40 Tax-interacting protein 40 TIP-40PAR6; par-6 partitioning defective 6 homolog alpha; PAR6C; Partitioning defective 6 homolog alpha; partitioning defective-6 homolog alpha; partitioning-defective protein 6; Tax interaction protein 40; Tax-interacting protein 40; TIP-40
Gene Aliases: PAR-6A; PAR6; PAR6A; PAR6alpha; PAR6C; PARD6A; TAX40; TIP-40
UniProt ID: (Human) Q9NPB6
Entrez Gene ID: (Human) 50855
Molecular Function: cell junction protein tight junction
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.