Novus Biologicals
Manufacturer Code:NBP15513520UL
Catalog # NBP15513520
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PAPSS2(3'-phosphoadenosine 5'-phosphosulfate synthase 2) The peptide sequence was selected from the C terminal of PAPSS2. Peptide sequence PARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLEKN. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 3'-phosphoadenosine 5'-phosphosulfate synthase 2 ATP sulfurylase/adenosine 5'-phosphosulfate kinase ATPSK2ATP sulfurylase/APS kinase 2 bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2 bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthethase 2 EC 2.7.1.25 PAPS synthase 2 PAPS synthetase 2 PAPSS 2 SK 2 SK2 Sulfurylase kinase 23-prime-phosphoadenosine 5-prime-phosphosulfate synthase 2; 3'-phosphoadenosine-5'-phosphosulfate synthase; 3-prime-phosphoadenosine 5-prime-phosphosulfate synthase 2; adenosine 5'-phosphosulfate kinase; Adenosine-5'-phosphosulfate 3'-phosphotransferase; Adenylyl-sulfate kinase; Adenylylsulfate 3'-phosphotransferase; APS kinase; ATP sulfurylase/adenosine 5'-phosphosulfate kinase; ATP sulfurylase/APS kinase 2; ATP-sulfurylase; Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2; bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthethase 2; PAPS synthase 2; PAPS synthetase 2; SAT; SK 2; Sulfate adenylate transferase; Sulfate adenylyltransferase; Sulfurylase kinase 2
Gene Aliases: ATPSK2; BCYM4; PAPSS2; SK2
UniProt ID: (Human) O95340
Entrez Gene ID: (Human) 9060
Molecular Function:
kinase
nucleotidyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.