Novus Biologicals
Manufacturer Code:NBP213730
Catalog # NBP213730
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QERDIVPVDASYEVKELYVPENKLHLAKTDAETLPALKINKVDMQWVQVL AE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 3'-phosphoadenosine 5'-phosphosulfate synthase 1 ATPSK1SK 1 bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1 EC 2.7.1.25 PAPS synthase 1 PAPSS 1 PAPSS3-prime-phosphoadenosine 5-prime-phosphosulfate synthase 1 SK1 Sulfurylase kinase 1; 3'-phosphoadenosine-5'-phosphosulfate synthase; 3-prime-phosphoadenosine 5-prime-phosphosulfate synthase 1; Adenosine-5'-phosphosulfate 3'-phosphotransferase; Adenylyl-sulfate kinase; Adenylylsulfate 3'-phosphotransferase; APS kinase; ATP-sulfurylase; Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1; PAPS synthase 1; PAPSS 1; SAT; SK 1; Sulfate adenylate transferase; Sulfate adenylyltransferase; Sulfurylase kinase 1
Gene Aliases: ATPSK1; PAPSS; PAPSS1; SK1
UniProt ID: (Human) O43252
Entrez Gene ID: (Human) 9061
Molecular Function:
kinase
nucleotidyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.