Novus Biologicals
Manufacturer Code:NBP17066920UL
Catalog # NBP17066920
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PAOX(polyamine oxidase (exo-N4-amino)) The peptide sequence was selected from the N terminal of PAOX. Peptide sequence HSAFPHLRVLEATARAGGRIRSERCFGGVVEVGAHWIHGPSRGNPVFQLA. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DKFZp434J245 MGC45464 PAO polyamine oxidase polyamine oxidase (exo-N4-amino); Peroxisomal N(1)-acetyl-spermine/spermidine oxidase; peroxisomal N1-acetyl-spermine/spermidine oxidase; Polyamine oxidase
Gene Aliases: PAO; PAOX; UNQ1923/PRO4398
UniProt ID: (Human) Q6QHF9
Entrez Gene ID: (Human) 196743
Molecular Function: DNA binding protein DNA methyltransferase methyltransferase nucleic acid binding oxidase oxidoreductase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.