Novus Biologicals
Manufacturer Code:NBP213724
Catalog # NBP213724
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EVMPVFPDFKMWINPCAQVIFDSDPAPKDTSGAAALEMMSQAMIRGMMDE EGNQFVAYFLPVEETLKKRKRDQEEEMDYAPDDVY |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: F23149_1 FLJ11123 Paf1 RNA polymerase II associated factor homolog (S. cerevisiae) Pancreatic differentiation protein 2 PD2hPAF1 RNA polymerase II-associated factor 1 homolog; hPAF1; Paf1, RNA polymerase II associated factor, homolog; Pancreatic differentiation protein 2; RNA polymerase II-associated factor 1 homolog
Gene Aliases: F23149_1; PAF1; PD2
UniProt ID: (Human) Q8N7H5
Entrez Gene ID: (Human) 54623
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.