Novus Biologicals
Manufacturer Code:NBP187354
Catalog # NBP187354
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:RPVYTNHWAVQVLGGPAEADRVAAAHGYLNLGQIGNLEDYYHFYHSKTFKRSTLSSRGPHTFLRMDPQVKWLQQQEVKRRVKR |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 3.4.21 EC 3.4.21.61 EC 3.4.21.75 PACE4EC 3.4.21.- Paired basic amino acid cleaving enzyme 4 paired basic amino acid cleaving system 4 proprotein convertase subtilisin/kexin type 6 SPC4subtilisin-like protease Subtilisin/kexin-like protease PACE4 Subtilisin-like proprotein convertase 4; Paired basic amino acid cleaving enzyme 4; paired basic amino acid cleaving system 4; Proprotein convertase subtilisin/kexin type 6; SPC4; Subtilisin-like proprotein convertase 4; Subtilisin/kexin-like protease PACE4
Gene Aliases: PACE4; PCSK6; SPC4
UniProt ID: (Human) P29122
Entrez Gene ID: (Human) 5046
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.