Novus Biologicals
Manufacturer Code:NBP157529
Catalog # NBP157529
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PABPC1L2A(poly(A) binding protein cytoplasmic 1-like 2A) The peptide sequence was selected from the middle region of PABPC1L2A. Peptide sequence NGMFLNYRKIFVGRFKSHKEREAERGAWARQSTSADVKDFEEDTDEEATL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: MGC168104 PABPC1L2 PABPC1L2B poly(A) binding protein cytoplasmic 1-like 2A polyadenylate-binding protein 1-like 2 RBM32A RBM32B RNA binding motif protein 32A RNA-binding motif protein 32 RNA-binding protein 32; poly(A) binding protein, cytoplasmic 1-like 2A; Polyadenylate-binding protein 1-like 2; RNA binding motif protein 32A; RNA-binding motif protein 32; RNA-binding protein 32
Gene Aliases: PABPC1L2; PABPC1L2A; PABPC1L2B; RBM32A; RBM32B
UniProt ID: (Human) Q5JQF8
Entrez Gene ID: (Human) 340529
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.