Novus Biologicals
Manufacturer Code:NBP169246
Catalog # NBP169246
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to P2RY12(purinergic receptor P2Y G-protein coupled 12) The peptide sequence was selected from the N terminal of P2RY12 (NP_795345). VAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ADP receptor; ATP receptor; ATP receptor P2 purinoceptor subtype Y1 P2Y purinoceptor 1 P2Y1platelet ADP receptor Purinergic receptor purinergic receptor P2Y G-protein coupled 1; P2 purinoceptor subtype Y1; P2Y purinoceptor 1; P2Y1; platelet ADP receptor; Purinergic receptor; purinergic receptor P2Y, G-protein coupled, 1
Gene Aliases: P2RY1; P2Y1
UniProt ID: (Human) P47900
Entrez Gene ID: (Human) 5028
Molecular Function:
G-protein coupled receptor
receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.