Novus Biologicals
Manufacturer Code:NBP182393
Catalog # NBP182393
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide towards P2X2. Peptide sequence EHKVWDVEEYVKPPEGGSVVSIITRIEVTPSQTLGTCPESMRVHSSTCHL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ATP receptor; ATP receptor MGC129601 P2X purinoceptor 2 P2X2P2X Receptor subunit 2 Purinergic receptor purinergic receptor P2X ligand-gated ion channel 2; P2X purinoceptor 2; P2X Receptor, subunit 2; P2X2; Purinergic receptor; purinergic receptor P2X, ligand gated ion channel, 2; purinergic receptor P2X, ligand-gated ion channel, 2
Gene Aliases: DFNA41; P2RX2; P2X2
UniProt ID: (Human) Q9UBL9
Entrez Gene ID: (Human) 22953
Molecular Function: ion channel ligand-gated ion channel receptor transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.