Novus Biologicals
Manufacturer Code:NBP159222
Catalog # NBP159222
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to P-cadherin (placental)) The peptide sequence was selected from the N terminal of P-cadherin. Peptide sequence AVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQ. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: cadherin 3 P-cadherin (placental) cadherin 3 type 1 P-cadherin (placental) cadherin-3 CDHPcalcium-dependent adhesion protein placental HJMD PCADP-cadherin Placental cadherin; cadherin 3, type 1, P-cadherin (placental); Cadherin-3; calcium-dependent adhesion protein, placental; P-cadherin; Placental cadherin
Gene Aliases: CDH3; CDHP; HJMD; PCAD
UniProt ID: (Human) P22223
Entrez Gene ID: (Human) 1001
Molecular Function:
cadherin
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.