Novus Biologicals
Manufacturer Code:NBP183670
Catalog # NBP183670
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:AAEEPQQQKQEPLGSDSEGVNCLAYDEAIMAQQDRIQQEIAVQNPLVSERLELSVLYKEYAEDDNIYQQKIKDLHKKYSYIRKTRPD |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Deubiquitinating enzyme OTUB1; Deubiquitinating enzyme OTUB1 EC 3.1.2 EC 3.4.19.12 FLJ20113 FLJ40710 hOTU1 MGC111158 OTB1MGC4584 OTU domain ubiquitin aldehyde binding 1 OTU domain-containing ubiquitin aldehyde-binding protein 1 OTU1OTU-domain Ubal-binding 1 otubain-1 ubiquitin thioesterase OTUB1 ubiquitin-specific protease otubain 1 Ubiquitin-specific-processing protease OTUB1; hOTU1; OTU domain, ubiquitin aldehyde binding 1; OTU domain-containing ubiquitin aldehyde-binding protein 1; OTU-domain Ubal-binding 1; Otubain-1; Ubiquitin thioesterase OTUB1; ubiquitin-specific protease otubain 1; Ubiquitin-specific-processing protease OTUB1
Gene Aliases: HSPC263; OTB1; OTU1; OTUB1
UniProt ID: (Human) Q96FW1
Entrez Gene ID: (Human) 55611
Molecular Function:
hydrolase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.