Novus Biologicals
Manufacturer Code:NBP188627
Catalog # NBP188627
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:NSDSSSVSSRASSPDMDEMYLRDHHHRHHHHQESRLNSVSSTQGDMMQKMPGESLSRAGAKAAGESSKYKIKKQLSEQDLQQLRLKINGR |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: bHLHb7; Bhlhb7 BHLHE20 bHLHe20oligo3 Class B basic helix-loop-helix protein 7 Class E basic helix-loop-helix protein 20 Oligo3 oligodendrocyte transcription factor 3; bHLHe20; Class B basic helix-loop-helix protein 7; Class E basic helix-loop-helix protein 20; Oligo3; Oligodendrocyte transcription factor 3
Gene Aliases: BHLHB7; BHLHE20; OLIG3
UniProt ID: (Human) Q7RTU3
Entrez Gene ID: (Human) 167826
Molecular Function:
basic helix-loop-helix transcription factor
nuclease
nucleic acid binding
transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.