Novus Biologicals
Manufacturer Code:NBP232357
Catalog # NBP232357
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GTHPRMGNLGLQMEAENRMMLSSSPVIQLPEQTPLAFDNRFVPIYGNHSSVNSVTPQTSPLSLKKEIPENSAVDE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CHIT5 EGP Estrogen-dependent oviduct protein MUC9 mucin 9 mucin-9 OGP oviduct glycoprotein Oviductal glycoprotein oviductal glycoprotein 1 120kDa oviductin oviduct-specific glycoprotein; Estrogen-dependent oviduct protein; mucin 9; Mucin-9; oviduct glycoprotein; Oviduct-specific glycoprotein; Oviductal glycoprotein; oviductal glycoprotein 1, 120kDa; Oviductin
Gene Aliases: CHIT5; EGP; MUC9; OGP; OVGP1
UniProt ID: (Human) Q12889
Entrez Gene ID: (Human) 5016
Molecular Function: glycosidase hydrolase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.