Novus Biologicals
Manufacturer Code:NBP188095
Catalog # NBP188095
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:PHQDSIPSLEPGSHSKDGLHRGALLPPPYRVADSYSNGYREPPEPDGWAGGLRGLPPTQTKCKQPNCSFYG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Cellular zinc finger anti-NF-kappa-B protein; cellular zinc finger anti-NF-kappaB Cezanne; cellular zinc finger NF-kappaB Cezanne Cellular zinc finger NF-kappa-B protein CEZANNEA20 domain containing 1 EC 3.4.19.12 OTU domain containing 7B OTU domain-containing protein 7B ZA20D1 Zinc finger A20 domain-containing protein 1 Zinc finger protein Cezanne; Cezanne; OTU domain containing 7B; OTU domain-containing protein 7B; Zinc finger A20 domain-containing protein 1; Zinc finger protein Cezanne; zinc finger, A20 domain containing 1
Gene Aliases: CEZANNE; OTUD7B; ZA20D1
UniProt ID: (Human) Q6GQQ9
Entrez Gene ID: (Human) 56957
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.