Novus Biologicals
Manufacturer Code:NBP184947
Catalog # NBP184947
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:LRTCAAKLRPLTASQTVKTFSQNRPAAARTFQQIRCYSAPVAAEPFLSGTSSNYVEEMYCAWLENPKSV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 2-oxoglutarate dehydrogenase complex component E1; 2-oxoglutarate dehydrogenase complex component E1 2-oxoglutarate dehydrogenase mitochondrial AKGDH alpha KGD alpha-KGD E1k OGDC oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) oxoglutarate decarboxylase oxoglutarate dehydrogenase (succinyl-transferring); 2-oxoglutarate dehydrogenase, mitochondrial; Alpha-ketoglutarate dehydrogenase; OGDC-E1; oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide); oxoglutarate decarboxylase; oxoglutarate dehydrogenase (succinyl-transferring); testicular tissue protein Li 131
Gene Aliases: AKGDH; E1k; OGDC; OGDH
UniProt ID: (Human) Q02218
Entrez Gene ID: (Human) 4967
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.