Novus Biologicals
Manufacturer Code:NBP213687
Catalog # NBP213687
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EPSYELVKSQQWDDIPPIFGVQQQVARQAKAFLSLGKMAEVQVSRRRAGG AQSWLWFATVKSLIGKGVMLAVSQGRVQTNVLN |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ10474 FLJ10886 KIAA1455odd Oz/Ten-m homolog 3 odz odd Oz/ten-m homolog 3 (Drosophila) ODZ3-like protein Protein Odd Oz/ten-m homolog 3 ten-3 tenascin-M3 teneurin-3 Ten-m3 TNM3; odz, odd Oz/ten-m homolog 3; ODZ3-like protein; Protein Odd Oz/ten-m homolog 3; Ten-3; Ten-m3; Tenascin-M3; Teneurin transmembrane protein 3; Teneurin-3; testicular tissue protein Li 195
Gene Aliases: KIAA1455; MCOPCB9; ODZ3; ten-3; Ten-m3; TENM3; TNM3
UniProt ID: (Human) Q9P273
Entrez Gene ID: (Human) 55714
Molecular Function: membrane-bound signaling molecule receptor signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.