Novus Biologicals
Manufacturer Code:NBP160018
Catalog # NBP160018
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ODF4(outer dense fiber of sperm tails 4) The peptide sequence was selected from the N terminal of ODF4. Peptide sequence MDAEYSGNEFPRSEGERDQHQRPGKERKSGEAGWGTGELGQDGRLLSSTL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: cancer/testis antigen 134; cancer/testis antigen 134 cancer/testis antigen 136 CT134 CT136 hOPPO1 MGC138215 OPPO1MGC138219 outer dense fiber 4 outer dense fiber of sperm tails 4 Outer dense fiber of sperm tails protein 4 outer dense fiber protein 4 Testis-specific protein oppo 1; cancer/testis antigen 136; hOPPO1; outer dense fiber 4; Outer dense fiber of sperm tails protein 4; Outer dense fiber protein 4; Testis-specific protein oppo 1
Gene Aliases: CT134; CT136; ODF4; OPPO1
UniProt ID: (Human) Q2M2E3
Entrez Gene ID: (Human) 146852
Molecular Function:
cytoskeletal protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.