Novus Biologicals
Manufacturer Code:NBP257222
Catalog # NBP257222
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SQGRFEEAEVIIRKAAKANGIVVPSTIFDPSELQDLSSKKQQSHNILDLLRTWN |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CDSP FLJ46769 High-affinity sodium-dependent carnitine cotransporter OCTN2high-affinity sodium dependent carnitine cotransporter OCTN2VT organic cation transporter 2 organic cation transporter 5 Organic cation/carnitine transporter 2 SCD solute carrier family 22 (organic cation transporter) member 5 solute carrier family 22 (organic cation/carnitine transporter) member 5 solute carrier family 22 member 5; high-affinity sodium dependent carnitine cotransporter; High-affinity sodium-dependent carnitine cotransporter; Organic cation/carnitine transporter 2; Solute carrier family 22 member 5
Gene Aliases: CDSP; OCTN2; SLC22A5
UniProt ID: (Human) O76082
Entrez Gene ID: (Human) 6584
Molecular Function: carbohydrate transporter cation transporter transfer/carrier protein transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.