Novus Biologicals
Manufacturer Code:NBP19162620UL
Catalog # NBP19162620
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Mouse |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards OASL. Peptide sequence ICLLDTISPEIQVFVKNPDGRSHAYAIHPLDYVLNLKQQIEDRQGLRCQE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 2'-5'-OAS-related protein; 2'-5'-OAS-RP; 2'-5'-oligoadenylate synthase-like protein; 2'-5'-oligoadenylate synthetase-like; 2'-5'-oligoadenylate synthetase-like p59 OASL p59OASL59 kDa 2'-5'-oligoadenylate synthase-like protein Thyroid receptor-interacting protein 1459 kDa 2'-5'-oligoadenylate synthetase-like protein TRIP-14 TRIP14TR-interacting protein 14; 59 kDa 2'-5'-oligoadenylate synthase-like protein; 59 kDa 2'-5'-oligoadenylate synthetase-like protein; p59 OASL; p59OASL; Thyroid receptor-interacting protein 14; TR-interacting protein 14
Gene Aliases: OASL; OASLd; p59 OASL; p59-OASL; p59OASL; TRIP-14; TRIP14
UniProt ID: (Human) Q15646
Entrez Gene ID: (Human) 8638
Molecular Function: defense/immunity protein nucleic acid binding nucleotidyltransferase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.