Novus Biologicals
Manufacturer Code:NBP185841
Catalog # NBP185841
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:TWDLGNGAAWHWDLLAQEAASCYDHPCFLRGMGDPVQSWKGPGLPRAGCSGLGHPIQLDPNQKTPENSKSLNAVYPRAGSKPPSCP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: (2-5')oligo(A) synthase 3; (2-5')oligo(A) synthase 32'-5'oligoadenylate synthetase p100 2-5A synthase 3 2'-5'-oligoadenylate synthase 3 2'-5'-oligoadenylate synthetase 3 100kDa P/OKcl.4 p100 OAS; (2-5')oligo(A) synthetase 3; 2'-5'-oligoadenylate synthase 3; 2'-5'-oligoadenylate synthetase 3, 100kDa; 2'-5'oligoadenylate synthetase p100; 2-5A synthase 3; 2-5A synthetase 3; p100 OAS; p100OAS
Gene Aliases: OAS3; P/OKcl.4; p100; p100OAS
UniProt ID: (Human) Q9Y6K5
Entrez Gene ID: (Human) 4940
Molecular Function:
defense/immunity protein
nucleic acid binding
nucleotidyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.