Novus Biologicals
Manufacturer Code:NBP158951
Catalog # NBP158951
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to OAS2(2'-5'-oligoadenylate synthetase 2 69/71kDa) The peptide sequence was selected from the N terminal of OAS2. Peptide sequence DEMVNTICDVLQEPEQFPLVQGVAIGGSYGRKTVLRGNSDGTLVLFFSDL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: (2'-5')oligo(A) synthetase 2; (2-5')oligo(A) synthase 2; (2-5')oligo(A) synthase 2 (2'-5')oligo(A) synthetase 2 (2-5')oligo(A) synthetase 2 2'5' oligoadenylate synthetase 2 2-5A synthase 2 2-5A synthetase 2 2'-5'-oligoadenylate synthase 2 2'-5'-oligoadenylate synthetase 2 (69-71 kD) 2'-5'-oligoadenylate synthetase 2 69/71kDa EC 2.7.7 EC 2.7.7.- MGC78578 p69 OAS p71 OAS p69OAS p71OAS; 2'-5'-oligoadenylate synthase 2; 2'-5'-oligoadenylate synthetase 2, 69/71kDa; 2-5A synthase 2; p69 OAS / p71 OAS; p69OAS / p71OAS
Gene Aliases: OAS2
UniProt ID: (Human) P29728
Entrez Gene ID: (Human) 4939
Molecular Function:
defense/immunity protein
nucleic acid binding
nucleotidyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.