Novus Biologicals
Manufacturer Code:NBP158950
Catalog # NBP158950
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to OAS1(2'5'-oligoadenylate synthetase 1 40/46kDa) The peptide sequence was selected from the C terminal of OAS1. Peptide sequence GWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLVRPPASSLPFIPAPLHEA. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: (2-5')oligo(A) synthase 1; (2-5')oligo(A) synthase 12'-5'-oligoadenylate synthetase 12-5A synthase 12'-5'-oligoisoadenylate synthetase 1 (2-5')oligo(A) synthetase 1 2'-5'-oligo A synthetase 1 2'-5'-oligoadenylate synthase 1 2'-5'-oligoadenylate synthetase 1 (40-46 kD) 2'-5'-oligoadenylate synthetase 1 40/46kDa E18/E162-5A synthetase 1 EC 2.7.7 EC 2.7.7.- IFI-42'-5' oligoadenylate synthetase 1 p52 isoform OIAS2'-5' oligoadenylate synthetase 1 p48 isoform OIASI p46/p42 OAS; 2',5'-oligo A synthetase 1; 2'-5'-oligoadenylate synthase 1; 2'-5'-oligoadenylate synthetase 1, 40/46kDa; 2'-5'-oligoisoadenylate synthetase 1; 2-5A synthase 1; 2-5A synthetase 1; E16 (2'-5') oligo A synthetase; E18/E16; p46/p42 OAS
Gene Aliases: E18/E16; IFI-4; OAS1; OIAS; OIASI
UniProt ID: (Human) P00973
Entrez Gene ID: (Human) 4938
Molecular Function:
defense/immunity protein
nucleic acid binding
nucleotidyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.