Novus Biologicals
Manufacturer Code:NBP255985
Catalog # NBP255985
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ILTGADGKNLTKNDLYPNPKPEVLHMIYMRALQIVYGIRLEHFYMMPVNSEVMYPHLMEGFLPFSNLVTHLDSF |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: cancer/testis antigen 106; cancer/testis antigen 106 CDCA1hsNuf2 cell division cycle associated 1 Cell division cycle-associated protein 1 CT106 hNuf2 kinetochore protein Nuf2 NUF2 NDC80 kinetochore complex component homolog (S. cerevisiae) NUF2RhNuf2R; cell division cycle associated 1; Cell division cycle-associated protein 1; hNuf2; hNuf2R; hsNuf2; Kinetochore protein Nuf2; NUF2, NDC80 kinetochore complex component, homolog
Gene Aliases: CDCA1; CT106; NUF2; NUF2R
UniProt ID: (Human) Q9BZD4
Entrez Gene ID: (Human) 83540
Molecular Function:
structural protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.