Novus Biologicals
Manufacturer Code:NBP238325
Catalog # NBP238325
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KQQQKLDRQKELEKKRKLETNPDIKPSNVEPMEKEFGLCKTENKAKSGKQNSKKLYCQELKKVIEASDVVLE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C77032 E2IG3NNP47 estradiol-induced nucleotide binding protein guanine nucleotide binding protein-like 3 (nucleolar) guanine nucleotide-binding protein-like 3 MGC800 Novel nucleolar protein 47 NSE2-induced gene 3 protein Nucleolar GTP-binding protein 3 nucleostemin; E2-induced gene 3 protein; estradiol-induced nucleotide binding protein; guanine nucleotide binding protein-like 3 (nucleolar); Guanine nucleotide-binding protein-like 3; NNP47; Novel nucleolar protein 47; Nucleolar GTP-binding protein 3; Nucleostemin
Gene Aliases: C77032; E2IG3; GNL3; NNP47; NS
UniProt ID: (Human) Q9BVP2
Entrez Gene ID: (Human) 26354
Molecular Function:
G-protein
enzyme modulator
hydrolase
nucleic acid binding
peptide hormone
signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.