Novus Biologicals
Manufacturer Code:NBP258712
Catalog # NBP258712
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SQTNFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNKK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C8orf36 E3 SUMO-protein ligase NSE2 EC 6.3.2 EC 6.3.2.- FLJ32440 hMMS21 methyl methanesulfonate sensitivity gene 21 MMS21 homolog MMS21chromosome 8 open reading frame 36 Non-SMC element 2 homolog non-SMC element 2 homolog (MMS21 S. cerevisiae) non-SMC element 2 MMS21 homolog (S. cerevisiae) Non-structural maintenance of chromosomes element 2 homolog NSE2; E3 SUMO-protein ligase NSE2; E3 SUMO-protein transferase NSE2; hMMS21; methyl methanesulfonate sensitivity gene 21; MMS21 homolog; Non-SMC element 2 homolog; non-SMC element 2, MMS21 homolog; Non-structural maintenance of chromosomes element 2 homolog; zinc finger, MIZ-type containing 7
Gene Aliases: C8orf36; MMS21; NSE2; NSMCE2; ZMIZ7
UniProt ID: (Human) Q96MF7
Entrez Gene ID: (Human) 286053
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.