Novus Biologicals
Manufacturer Code:NBP16912220UL
Catalog # NBP1692220
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to CHRNA5 (cholinergic receptor nicotinic alpha 5) The peptide sequence was selected from the middle region of CHRNA5. Peptide sequence PDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFD. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: acetylcholine receptor, nicotinic, alpha 5 (neuronal); Cholinergic receptor neuronal nicotinic alpha polypeptide-5 cholinergic receptor nicotinic alpha 5 cholinergic receptor nicotinic alpha polypeptide 5 LNCR2 NACHRA5 neuronal acetylcholine receptor subunit alpha-5 neuronal nicotinic acetylcholine receptor alpha5 subunit; Cholinergic receptor, neuronal nicotinic, alpha polypeptide-5; cholinergic receptor, nicotinic alpha 5; cholinergic receptor, nicotinic, alpha 5 (neuronal); Neuronal acetylcholine receptor subunit alpha-5; neuronal nicotinic acetylcholine receptor, alpha5 subunit
Gene Aliases: CHRNA5; LNCR2; NACHRA5
UniProt ID: (Human) P30532
Entrez Gene ID: (Human) 1138
Molecular Function:
GABA receptor
acetylcholine receptor
ion channel
ligand-gated ion channel
receptor
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.