Novus Biologicals
Manufacturer Code:NBP238231
Catalog # NBP238231
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: WVSVTDFGAPCLRWAEVPPFLERSPPASWAQLRGQRHNFCRSPDGAGRPWCFYGDARGKVDWGYCDCRHGSVRLRGGK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: brain-specific serine protease 3; brain-specific serine protease 3 BSSP3 BSSP-3 EC 3.4.21 leydin MGC12722 Motopsin MRT1EC 3.4.21.- neurotrypsin protease serine 12 (neurotrypsin motopsin) Serine protease 12; Leydin; Motopsin; Neurotrypsin; protease, serine, 12 (neurotrypsin, motopsin); Serine protease 12
Gene Aliases: BSSP-3; BSSP3; MRT1; PRSS12
UniProt ID: (Human) P56730
Entrez Gene ID: (Human) 8492
Molecular Function:
hydrolase
oxidase
oxidoreductase
protease
receptor
serine protease
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.