Novus Biologicals
Manufacturer Code:NBP160045
Catalog # NBP160045
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to NTSR1(neurotensin receptor 1 (high affinity)) The peptide sequence was selected from the N terminal of NTSR1. Peptide sequence FGNASGNASERVLAAPSSELDVNTDIYSKVLVTAVYLALFVVGTVGNTVT. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: High-affinity levocabastine-insensitive neurotensin receptor; High-affinity levocabastine-insensitive neurotensin receptor neurotensin receptor 1 (high affinity) neurotensin receptor type 1 NTR NTR1 NT-R-1 NTRH NTRR; Neurotensin receptor type 1; NT-R-1; NTR1; NTRH
Gene Aliases: NTR; NTRR; NTSR1
UniProt ID: (Human) P30989
Entrez Gene ID: (Human) 4923
Molecular Function: G-protein coupled receptor receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.