Novus Biologicals
Manufacturer Code:NBP162423
Catalog # NBP162423
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to NPTN(neuroplastin) The peptide sequence was selected from the middle region of NPTN. Peptide sequence MEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKN. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: GP55Stromal cell-derived receptor 1 GP65SDR-1 MGC102805 neuroplastin np55 np65 SDFR1DKFZp686L2477 SDR1stromal cell derived factor receptor 1; Neuroplastin; SDR-1; stromal cell derived factor receptor 1; Stromal cell-derived receptor 1
Gene Aliases: GP55; GP65; np55; np65; NPTN; SDFR1; SDR1
UniProt ID: (Human) Q9Y639
Entrez Gene ID: (Human) 27020
Molecular Function:
transmembrane receptor regulatory/adaptor protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.