R&D Systems
Manufacturer Code:MAB8517
Catalog # MAB8517
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Mouse |
Class | Monoclonal |
Type | Antibody |
Clone | 904032 |
Immunogen | Neuropeptide Y/NPY conjugated to KLH YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY Accession # P01303 |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt -20 to -70 degreesC as supplied. 1 month 2 to 8 degreesC under sterile conditions after reconstitution. 6 months -20 to -70 degreesC under sterile con |
Mouse Monoclonal Antibody
For Research Use Only
Protein Aliases: 170 kDa melanoma membrane-bound gelatinase DKFZp686G13158 DPPIV EC 3.4.21.- FAPA Fibroblast activation protein alpha fibroblast activation protein alpha Integral membrane serine protease NPY PYY4 seprase; C-flanking peptide of NPY; CPON; Neuropeptide tyrosine; Neuropeptide Y; NPY; prepro-neuropeptide Y; Pro-neuropeptide Y
Gene Aliases: NPY; PYY4
UniProt ID: (Human) P01303
Entrez Gene ID: (Human) 4852
Molecular Function:
neuropeptide
peptide hormone
signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.