Novus Biologicals
Manufacturer Code:NBP192189
Catalog # NBP192189
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:RFQAAFQNVISSFHKQWHSQHDPQLPPAQRNIFLTECHFVELTEDIGPQFPCQSSMHNSHLPTALSSEQMSRTNYQSFHFN |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FM4 G-protein coupled receptor FM-4 G-protein coupled receptor TGR-1 growth hormone secretagogue receptor family member 4 neuromedin U receptor 2 neuromedin-U receptor 2 NMU2RFM-4 NMU-R2 TGR1 TGR-1; G-protein coupled receptor FM-4; G-protein coupled receptor TGR-1; growth hormone secretagogue receptor family, member 4; Neuromedin-U receptor 2; NMU-R2
Gene Aliases: FM-4; FM4; NMU-R2; NMU2R; NMUR2; TGR-1; TGR1
UniProt ID: (Human) Q9GZQ4
Entrez Gene ID: (Human) 56923
Molecular Function:
G-protein coupled receptor
receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.