Novus Biologicals
Manufacturer Code:NBP170757
Catalog # NBP170757
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to Netrin-4 The peptide sequence was selected from the C terminal of Netrin-4. Peptide sequence FPRTWWQSAEDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDF. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Beta-netrin; beta-netrin hepar-derived netrin-like protein netrin 4 NTN4 PRO3091; Hepar-derived netrin-like protein; Netrin-4
Gene Aliases: NTN4; PRO3091
UniProt ID: (Human) Q9HB63
Entrez Gene ID: (Human) 59277
Molecular Function:
extracellular matrix linker protein
extracellular matrix protein
receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.