Novus Biologicals
Manufacturer Code:NBP159110
Catalog # NBP159110
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to NPHP1(nephronophthisis 1 (juvenile)) The peptide sequence was selected from the middle region of NPHP1. Peptide sequence GILFELGISYIRNSTGERGELSCGWVFLKLFDASGVPIPAKTYELFLNGG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ97602 JBTS4NPH1Juvenile nephronophthisis 1 protein nephrocystin 1 nephrocystin-1 nephronophthisis 1 (juvenile) SLSN1; Juvenile nephronophthisis 1 protein; Nephrocystin-1; nephronophthisis 1 (juvenile)
Gene Aliases: JBTS4; NPH1; NPHP1; SLSN1
UniProt ID: (Human) O15259
Entrez Gene ID: (Human) 4867
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.