Novus Biologicals
Manufacturer Code:NBP170658
Catalog # NBP170658
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to NPNT(nephronectin) The peptide sequence was selected from the middle region of NPNT. Peptide sequence TTGLTTIAPAASTPPGGITVDNRVQTDPQKPRGDVFIPRQPSNDLFEIFE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Nephronectin; Preosteoblast EGF-like repeat protein with MAM domain; Protein EGFL6-like
Gene Aliases: EGFL6L; NPNT; POEM; UNQ295/PRO334
UniProt ID: (Human) Q6UXI9
Entrez Gene ID: (Human) 255743
Molecular Function:
extracellular matrix protein
extracellular matrix structural protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.