Novus Biologicals
Manufacturer Code:NBP189651
Catalog # NBP189651
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:SVNGSHKYKGNSKDVKPPDLWIHHERLELKPIDKSPDPNPIMTDTPIPRNSQDITPVDNSMDSNIHQRRNSYRGHESEDSMSTLAGR |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: HsT17534 IGDCC2DKFZp547B146 Immunoglobulin superfamily DCC subclass member 2 neogenin neogenin (chicken) homolog 1 neogenin 1 neogenin homolog 1 NGNDKFZp547A066; Immunoglobulin superfamily DCC subclass member 2; Neogenin; neogenin homolog 1
Gene Aliases: IGDCC2; NEO1; NGN; NTN1R2
UniProt ID: (Human) Q92859
Entrez Gene ID: (Human) 4756
Molecular Function: G-protein coupled receptor cell adhesion molecule cytokine receptor defense/immunity protein hydrolase immunoglobulin receptor superfamily immunoglobulin superfamily cell adhesion molecule phosphatase protein phosphatase receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.