Novus Biologicals
Manufacturer Code:NBP234213
Catalog # NBP234213
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SDPAHYIPPLTFVPVTVPAYWQIHMERVKVG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: asp 4; Asp 4 ASP4 Aspartyl protease 4 EC 3.4.23 EC 3.4.23.- EC 3.4.23.15 EC 3.4.23.3 EC 3.4.23.5 KAP Kdap NAP1napsin-A NAPApronapsin A NAPSA napsin A aspartic peptidase napsin-1 SNAPA TA01/TA02; ASP4; Aspartyl protease 4; kidney-derived aspartic protease-like protein; Napsin-1; Napsin-A; pronapsin A; TA01/TA02
Gene Aliases: KAP; Kdap; NAP1; NAPA; NAPSA; SNAPA
UniProt ID: (Human) O96009
Entrez Gene ID: (Human) 9476
Molecular Function: aspartic protease hydrolase protease
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.