Novus Biologicals
Manufacturer Code:NBP153047
Catalog # NBP153047
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to NUSAP1(nucleolar and spindle associated protein 1) The peptide sequence was selected from the middle region of NUSAP1. Peptide sequence AENAVSSGNRDSKVPSEGKKSLYTDESSKPGKNKRTAITTPNFKKLHEAH. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ANKTNUSAP BM037 FLJ13421 LNP nucleolar and spindle associated protein 1 nucleolar and spindle-associated protein 1 nucleolar protein ANKT NuSAP NuSAP1 PRO0310p1 Q0310 SAPL; Nucleolar and spindle-associated protein 1; nucleolar protein ANKT; NuSAP
Gene Aliases: ANKT; BM-037; BM037; LNP; NUSAP; NUSAP1; PRO0310; PRO0310p1; Q0310; SAPL
UniProt ID: (Human) Q9BXS6
Entrez Gene ID: (Human) 51203
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.