Novus Biologicals
Manufacturer Code:NBP213684
Catalog # NBP213684
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RNTLNIDKLKIETALELKNAEIALRTQKTPPGLQHEYAAPADYFRILVQQ FEVQLQQYRQQIEELENHLATQANNSHITPQDLSMAMQKI |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 58 kDa nucleoporin; KIAA0410PRO2463 nucleoporin like 1 nucleoporin p58/p45 Nucleoporin-like protein 1; nucleoporin 58kDa; nucleoporin like 1; Nucleoporin p58/p45; Nucleoporin-like protein 1
Gene Aliases: KIAA0410; NUP45; NUP58; NUPL1; PRO2463
UniProt ID: (Human) Q9BVL2
Entrez Gene ID: (Human) 9818
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.