Novus Biologicals
Manufacturer Code:NBP15818820UL
Catalog # NBP15818820
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to NUP98(nucleoporin 98kDa) The peptide sequence was selected from the N terminal of NUP98. Peptide sequence EELRLEDYQANRKGPQNQVGAGTTTGLFGSSPATSSATGLFSSSTTNSGF. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 96 kDa nucleoporin; 98 kDa nucleoporin; ADAR2 ADIR2 GLFG-repeat containing nucleoporin nuclear pore complex protein Nup98-Nup96 nucleoporin 98kD nucleoporin 98kDa NUP196 NUP96 Nup98-Nup96; GLFG-repeat containing nucleoporin; Nuclear pore complex protein Nup96; Nuclear pore complex protein Nup98; Nuclear pore complex protein Nup98-Nup96; nucleoporin 98kD; nucleoporin 98kDa; Nucleoporin Nup96; Nucleoporin Nup98; Nup96; Nup98; Nup98-Nup96; NUP98/PHF23 fusion 2 protein
Gene Aliases: ADAR2; ADIR2; NUP196; NUP96; NUP98
UniProt ID: (Human) P52948
Entrez Gene ID: (Human) 4928
Molecular Function: transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.