Novus Biologicals
Manufacturer Code:NBP258412
Catalog # NBP258412
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FDSPEELPKERSSLLAVSNKYGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVPMKFPIHHLALSCDNLTLSACMMSSEY |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 214 kDa nucleoporin; 214 kDa nucleoporin CAINputative oncogene D9S46Enuclear pore complex protein Nup214 KIAA0023 MGC104525 N214 nucleoporin 214kD (CAIN) nucleoporin 214kDa Nucleoporin Nup214 p250 Protein CAN; CAN protein, putative oncogene; Nuclear pore complex protein Nup214; nucleoporin 214kDa; Nucleoporin Nup214; Protein CAN
Gene Aliases: CAIN; CAN; KIAA0023; NUP214
UniProt ID: (Human) P35658
Entrez Gene ID: (Human) 8021
Molecular Function: RNA binding protein nucleic acid binding structural protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.