Novus Biologicals
Manufacturer Code:NBP257066
Catalog # NBP257066
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALR |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Ap4A hydrolase; Ap4A hydrolase 1; Ap4A hydrolase Ap4A hydrolase 1 Ap4Aase APAH1Diadenosine 5'-5'''-P1 bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] diadenosine 5'-5''-P1 Diadenosine tetraphosphatase EC 3.6.1.17 MGC10404 Nucleoside diphosphate-linked moiety X motif 2 nudix (nucleoside diphosphate linked moiety X)-type motif 2 Nudix motif 2 P4-tetraphosphate asymmetrical hydrolase P4-tetraphosphate pyrophosphohydrolase; Ap4Aase; bis(5'-nucleosyl)-tetraphosphatase (asymmetrical); Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]; Diadenosine 5',5'''-P1,P4-tetraphosphate asymmetrical hydrolase; diadenosine 5',5''-P1,P4-tetraphosphate pyrophosphohydrolase; diadenosine tetraphosphatase; Nucleoside diphosphate-linked moiety X motif 2; nudix (nucleoside diphosphate linked moiety X)-type motif 2; Nudix motif 2
Gene Aliases: APAH1; NUDT2
UniProt ID: (Human) P50583
Entrez Gene ID: (Human) 318
Molecular Function:
hydrolase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.