Novus Biologicals
Manufacturer Code:NBP256146
Catalog # NBP256146
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LTLHHLVVEIKGLLGLQHLGRDHSDGICLNVLVTVAFRSPGIQDEPPKVRGENFSWWKVMEEDLQSQLLQRLQGSSVVPVN |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 2-hydroxy-dADP phosphatase; 7,8-dihydro-8-oxoguanine phosphatase; 8-oxo-dGDP phosphatase NUDT18; EC 3.6.1 EC 3.6.1.- FLJ22494 nucleoside diphosphate-linked moiety X motif 18 nudix (nucleoside diphosphate linked moiety X)-type motif 18 Nudix motif 18; MutT homolog 3; mutT human homolog 3; Nucleoside diphosphate-linked moiety X motif 18; nudix (nucleoside diphosphate linked moiety X)-type motif 18; Nudix motif 18
Gene Aliases: MTH3; NUDT18
UniProt ID: (Human) Q6ZVK8
Entrez Gene ID: (Human) 79873
Molecular Function:
hydrolase
phosphorylase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.