Novus Biologicals
Manufacturer Code:NBP238436
Catalog # NBP238436
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EKENYHYVTILMKGEVDVTHDSEPKNVEPEKNESWEWVPWEELPPLDQLFWGLRCLKEQGYDPFKEDLNHLVGYKGNHL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 8-oxo-dGTPase NUDT15; 8-oxo-dGTPase NUDT15 A730068G11Rik EC 3.1.6.- FLJ10956 MTH2MGC104352 MutT homolog 2 Nucleoside diphosphate-linked moiety X motif 15 nudix (nucleoside diphosphate linked moiety X)-type motif 15 Nudix motif 15 nudix-type motif 15 probable 78-dihydro-8-oxoguanine triphosphatase NUDT15 RP11-90M2.1; MTH2; MutT homolog 2; Nucleoside diphosphate-linked moiety X motif 15; Nucleoside diphosphate-linked to another moiety X hydrolase 15; Nucleotide triphosphate diphosphatase NUDT15; nudix (nucleoside diphosphate linked moiety X)-type motif 15; Nudix hydrolase 15; Nudix motif 15; probable 7,8-dihydro-8-oxoguanine triphosphatase NUDT15
Gene Aliases: MTH2; NUDT15; NUDT15D
UniProt ID: (Human) Q9NV35
Entrez Gene ID: (Human) 55270
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.