Novus Biologicals
Manufacturer Code:NBP15492920UL
Catalog # NBP15492920
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to NUDT13(nudix (nucleoside diphosphate linked moiety X)-type motif 13) The peptide sequence was selected from the N terminal of NUDT13. Peptide sequence MSLYCGIACRRKFFWCYRLLSTYVTKTRYLFELKEDDDACKKAQQTGAFY. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DKFZp586P2219 EC 3.- nucleoside diphosphate-linked moiety X motif 13 nudix (nucleoside diphosphate linked moiety X)-type motif 13 Nudix motif 13 Protein KiSS-16; NAD(P)H pyrophosphatase NUDT13, mitochondrial; Nucleoside diphosphate-linked moiety X motif 13; nudix (nucleoside diphosphate linked moiety X)-type motif 13; Nudix motif 13; NUDT13; Protein KiSS-16
Gene Aliases: NUDT13
UniProt ID: (Human) Q86X67
Entrez Gene ID: (Human) 25961
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.