Novus Biologicals
Manufacturer Code:NBP15297420UL
Catalog # NBP15297420
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to NUDT12(nudix (nucleoside diphosphate linked moiety X)-type motif 12) The peptide sequence was selected from the C terminal of NUDT12. Peptide sequence LALAVSTEIKVDKNEIEDARWFTREQVLDVLTKGKQQAFFVPPSRAIAHQ. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DeNADding enzyme NUDT12; DKFZp761I172 EC 3.6.1.22 nucleoside diphosphate linked moiety X-type motif 12 Nucleoside diphosphate-linked moiety X motif 12 nudix (nucleoside diphosphate linked moiety X)-type motif 12 Nudix motif 12 peroxisomal NADH pyrophosphatase NUDT12; NAD-capped RNA hydrolase NUDT12; NADH pyrophosphatase NUDT12; nucleoside diphosphate linked moiety X-type motif 12; Nucleoside diphosphate-linked moiety X motif 12; nudix (nucleoside diphosphate linked moiety X)-type motif 12; Nudix motif 12
Gene Aliases: NUDT12
UniProt ID: (Human) Q9BQG2
Entrez Gene ID: (Human) 83594
Molecular Function:
hydrolase
phosphorylase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.